- APOO Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-84746
- Western Blot, Immunocytochemistry/ Immunofluorescence
- This antibody was developed against Recombinant Protein corresponding to amino acids: IKKLVYPPGF MGLAASLYYP QQAIVFAQVS GERLYDWGLR GYIVIEDLWK ENFQKPGNVK NSPGTK
- MIC26, My025, MICOS26, Mic23, FAM121B
- Human
- Unconjugated
- 0.1 ml (also 25ul)
- PBS (pH 7.2) and 40% Glycerol
- APOO
- Rabbit
- apolipoprotein O
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
IKKLVYPPGFMGLAASLYYPQQAIVFAQVSGERLYDWGLRGYIVIEDLWKENFQKPGNVKNSPGTK
Specifications/Features
Available conjugates: Unconjugated